(data stored in ACNUC7421 zone)

EMBL: CP001349.PE50

CP001349.PE50        Location/Qualifiers
FT   CDS             complement(57500..58363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0051"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: met:M446_0051
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55102"
FT                   /db_xref="GOA:B8IU57"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU57"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACL55102.1"
FT                   /translation="MPWLDGQLHDGPIAPFDLTDRGLLLGDGVFDTALVLNGRVVFEAA
FT                   HVGRLVGSAAALGFALEPKTVRAAMRAMAEGQTRAALRTTATRGSGPRGLRPPLEPHPR
FT                   LLASAAPLHGPGSAFAPLSLHLTGIRRNDTSPASRHKTLGYLDAVLAAAEAARVGCDEA
FT                   MFLNTSGQVACAGTGNLFAVFGEALVTPPLADGVLAGIVRGWILAEAPGLGLSVAERSI
FT                   GPADLAEADALLVTNSLRLIAPVRALDARSYPGDHPTARRLADALRAAIAAETGRDPAP
FT                   LGRDLA"
     MPWLDGQLHD GPIAPFDLTD RGLLLGDGVF DTALVLNGRV VFEAAHVGRL VGSAAALGFA        60
     LEPKTVRAAM RAMAEGQTRA ALRTTATRGS GPRGLRPPLE PHPRLLASAA PLHGPGSAFA       120
     PLSLHLTGIR RNDTSPASRH KTLGYLDAVL AAAEAARVGC DEAMFLNTSG QVACAGTGNL       180
     FAVFGEALVT PPLADGVLAG IVRGWILAEA PGLGLSVAER SIGPADLAEA DALLVTNSLR       240
     LIAPVRALDA RSYPGDHPTA RRLADALRAA IAAETGRDPA PLGRDLA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page