(data stored in ACNUC7421 zone)

EMBL: CP001349.PE500

CP001349.PE500       Location/Qualifiers
FT   CDS             complement(577100..577954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0511"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; KEGG: met:M446_1620
FT                   prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55552"
FT                   /db_xref="GOA:B8ICG4"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG4"
FT                   /inference="protein motif:PFAM:PF00800"
FT                   /protein_id="ACL55552.1"
FT                   /translation="MTRTISYQGEPGANSHIICAEAYPDWTPLPCATFEDALTAVSDGT
FT                   ADLGMIPIENSIAGRVADIHHLLPASGLHIVGEQFLPIHFQLMALPGADPEKIRTVYSH
FT                   VHALGQCRKVIRRRGLKAVVAADTAGAAREVALSGDPTRASLSPRLAAEIYGLSIIEED
FT                   VEDEAHNTTRFVVLAREPSPPPPESGPTVTSFVFRVRNLPAALYKALGGFATNGVNMTK
FT                   LESYMVEGQFTATQFYAEVDGHPEEAPLRRALDELSFFSRELRIIGTYPAHPFRESTRL
FT                   VAE"
     MTRTISYQGE PGANSHIICA EAYPDWTPLP CATFEDALTA VSDGTADLGM IPIENSIAGR        60
     VADIHHLLPA SGLHIVGEQF LPIHFQLMAL PGADPEKIRT VYSHVHALGQ CRKVIRRRGL       120
     KAVVAADTAG AAREVALSGD PTRASLSPRL AAEIYGLSII EEDVEDEAHN TTRFVVLARE       180
     PSPPPPESGP TVTSFVFRVR NLPAALYKAL GGFATNGVNM TKLESYMVEG QFTATQFYAE       240
     VDGHPEEAPL RRALDELSFF SRELRIIGTY PAHPFRESTR LVAE                        284
//

If you have problems or comments...

PBIL Back to PBIL home page