(data stored in ACNUC7421 zone)

EMBL: CP001349.PE501

CP001349.PE501       Location/Qualifiers
FT   CDS             complement(578082..578825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0512"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase; KEGG: met:M446_1619
FT                   3-deoxy-D-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55553"
FT                   /db_xref="GOA:B8ICG5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICG5"
FT                   /inference="protein motif:TFAM:TIGR00466"
FT                   /protein_id="ACL55553.1"
FT                   /translation="MSDPLILIPARLGATRLPDKPLADICGEPMIVHVWRRAIAAGLGP
FT                   VVVCTDAPTVVAAVEAVGGLAVLTRPDHPSGSDRLAEALGIIDPEGRHDVVVNLQGDLP
FT                   TIDPGIVAAAVTPLADRAVDIATLCAVITRDEERTEPSVVKLVGSPITPTRLRALYFTR
FT                   ATAPWGEGPLYHHIGLYAYRRRALERFVSLSPSVLERREKLEQLRALEAGMRIDAVVVD
FT                   DVPLGVDTPHDLDRARAVMAARRLN"
     MSDPLILIPA RLGATRLPDK PLADICGEPM IVHVWRRAIA AGLGPVVVCT DAPTVVAAVE        60
     AVGGLAVLTR PDHPSGSDRL AEALGIIDPE GRHDVVVNLQ GDLPTIDPGI VAAAVTPLAD       120
     RAVDIATLCA VITRDEERTE PSVVKLVGSP ITPTRLRALY FTRATAPWGE GPLYHHIGLY       180
     AYRRRALERF VSLSPSVLER REKLEQLRAL EAGMRIDAVV VDDVPLGVDT PHDLDRARAV       240
     MAARRLN                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page