(data stored in ACNUC7421 zone)

EMBL: CP001349.PE502

CP001349.PE502       Location/Qualifiers
FT   CDS             579133..579675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0513"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: met:M446_1618
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55554"
FT                   /db_xref="GOA:B8ICG6"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG6"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACL55554.1"
FT                   /translation="MDSFELNKVAGAVLGTLLFAMGTGFLAELIYKPKPAGDHGYPLPA
FT                   AQEEPAGGGAAEAAKEEPLPVRLASADAAKGQSAAKKCAACHSFDKGGPNKVGPNLWGI
FT                   VGRPKGSHEGFNYSAAMKAKGGDWSYDDLDHFIHAPKGFVSGTIMAFAGVPSGAERADI
FT                   LAYLKTLSDKPVDFPKP"
     MDSFELNKVA GAVLGTLLFA MGTGFLAELI YKPKPAGDHG YPLPAAQEEP AGGGAAEAAK        60
     EEPLPVRLAS ADAAKGQSAA KKCAACHSFD KGGPNKVGPN LWGIVGRPKG SHEGFNYSAA       120
     MKAKGGDWSY DDLDHFIHAP KGFVSGTIMA FAGVPSGAER ADILAYLKTL SDKPVDFPKP       180
//

If you have problems or comments...

PBIL Back to PBIL home page