(data stored in ACNUC7421 zone)

EMBL: CP001349.PE503

CP001349.PE503       Location/Qualifiers
FT   CDS             579903..581756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0514"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1616 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55555"
FT                   /db_xref="GOA:B8ICG7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55555.1"
FT                   /translation="MIARRLAALALVCLTALPATAAEAPWRHGLSLLGTPKYPADFTHF
FT                   AYANPEAPKGGLLRLGFQGSFDNLNLVVAGVKGDLESEIPIIYDTLTTEAGDEPFTSYG
FT                   LLAESVQVAEDLGSVTYRLRPQAKWHDGAPVTPADVVFSFGVLKENSPQYAFYYHNVAK
FT                   AEAVGEREVRFTFSESGNRELPQIVGQMPVLPKHWWEGKDANGRPRNPTETSLEIPLGS
FT                   GPYRVARVEAGRTITYERVPDYWGRDIPVNKGRYNFDTLRNEYYRDATVLIEAFKADQF
FT                   DWRTENIARNWATAYDGFPAVREGRILKEEFPSRGSGIMQCFTFNMRRQKFADARVRRA
FT                   FNLAFDFEEMNRTLFYGLYKRIDSYFFGTELASSGLPEGREREILESVKDKIPAQVFTE
FT                   PYRNPVGGSPEAQRANLREAVRLLQAAGYTQRNGQMVEAATGQPLTVEFLGYDNSAERI
FT                   VLPYKQQLERLGIRVSLRIVDPAQYQNLVRSFDFDALALNSWPESLSPGNEQRDFWGSA
FT                   AADRPGSRNLAGIKDAGVDALIDKVIFASDRAELVAATRALDRVLLAHDYVVPQWAAGV
FT                   TRTLRWNRFSRPATLPQYGGSGFPWTWWYDQALAARTGVAR"
     MIARRLAALA LVCLTALPAT AAEAPWRHGL SLLGTPKYPA DFTHFAYANP EAPKGGLLRL        60
     GFQGSFDNLN LVVAGVKGDL ESEIPIIYDT LTTEAGDEPF TSYGLLAESV QVAEDLGSVT       120
     YRLRPQAKWH DGAPVTPADV VFSFGVLKEN SPQYAFYYHN VAKAEAVGER EVRFTFSESG       180
     NRELPQIVGQ MPVLPKHWWE GKDANGRPRN PTETSLEIPL GSGPYRVARV EAGRTITYER       240
     VPDYWGRDIP VNKGRYNFDT LRNEYYRDAT VLIEAFKADQ FDWRTENIAR NWATAYDGFP       300
     AVREGRILKE EFPSRGSGIM QCFTFNMRRQ KFADARVRRA FNLAFDFEEM NRTLFYGLYK       360
     RIDSYFFGTE LASSGLPEGR EREILESVKD KIPAQVFTEP YRNPVGGSPE AQRANLREAV       420
     RLLQAAGYTQ RNGQMVEAAT GQPLTVEFLG YDNSAERIVL PYKQQLERLG IRVSLRIVDP       480
     AQYQNLVRSF DFDALALNSW PESLSPGNEQ RDFWGSAAAD RPGSRNLAGI KDAGVDALID       540
     KVIFASDRAE LVAATRALDR VLLAHDYVVP QWAAGVTRTL RWNRFSRPAT LPQYGGSGFP       600
     WTWWYDQALA ARTGVAR                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page