(data stored in ACNUC7421 zone)

EMBL: CP001349.PE504

CP001349.PE504       Location/Qualifiers
FT   CDS             581753..583633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0515"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1615 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55556"
FT                   /db_xref="GOA:B8ICG8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG8"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55556.1"
FT                   /translation="MSATRRTLLSLAAGAALAGALPRPPRAQSGPQAPDAQADERHGLS
FT                   SFGELKYPRDFQRFDYVEPMAPRGGTFSAQIATTTGNQAFETFNTLNIYVLKGDGAAGM
FT                   DLTFDSLMTRALDEPDALYGLVARSVRVSPDGLTYRFALRPQARFHDGSRLTARDVAFS
FT                   IRTLKEKGHPRISQVLRDVADAVAEGDEAVSVTFAAGRSRDLPLIVAELPIFSEAYYGG
FT                   HDFEASTLEAPLGSGPYQVARFEVGRFIAFERVRDYWGADLPVNVGQNNFDEIRFEYFR
FT                   DRDVAFEAFKAGAFTWREEFTSRVWATGYDFPAAQEGRVKRETVPDATPSGTQGWWFNT
FT                   RRPIFKDPRIREAIGLAFDFEWSNQNLMYGAYRRTASFFENSDLKAEGPPGPEELALLE
FT                   PFRGRVPDEVFGPPWSPPRSDGSGQDRALLRRADALLREAGCTRDGGQLRLPDGQPLAF
FT                   EFLDSNPVFQPLVQPFIKNLGLLGIRATSRIVDPAQYQARLKDFDFDVVSARFGGSLTP
FT                   GAGLREVYGSRSAATPGSQNLAGIADPAVDALLDRVATAATRAELTVACRALDRCLRAG
FT                   RYWVPMWYSASHRLALWDIYGRPAELPKYGLGAPAIWWHDAARARRIGRG"
     MSATRRTLLS LAAGAALAGA LPRPPRAQSG PQAPDAQADE RHGLSSFGEL KYPRDFQRFD        60
     YVEPMAPRGG TFSAQIATTT GNQAFETFNT LNIYVLKGDG AAGMDLTFDS LMTRALDEPD       120
     ALYGLVARSV RVSPDGLTYR FALRPQARFH DGSRLTARDV AFSIRTLKEK GHPRISQVLR       180
     DVADAVAEGD EAVSVTFAAG RSRDLPLIVA ELPIFSEAYY GGHDFEASTL EAPLGSGPYQ       240
     VARFEVGRFI AFERVRDYWG ADLPVNVGQN NFDEIRFEYF RDRDVAFEAF KAGAFTWREE       300
     FTSRVWATGY DFPAAQEGRV KRETVPDATP SGTQGWWFNT RRPIFKDPRI REAIGLAFDF       360
     EWSNQNLMYG AYRRTASFFE NSDLKAEGPP GPEELALLEP FRGRVPDEVF GPPWSPPRSD       420
     GSGQDRALLR RADALLREAG CTRDGGQLRL PDGQPLAFEF LDSNPVFQPL VQPFIKNLGL       480
     LGIRATSRIV DPAQYQARLK DFDFDVVSAR FGGSLTPGAG LREVYGSRSA ATPGSQNLAG       540
     IADPAVDALL DRVATAATRA ELTVACRALD RCLRAGRYWV PMWYSASHRL ALWDIYGRPA       600
     ELPKYGLGAP AIWWHDAARA RRIGRG                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page