(data stored in ACNUC7421 zone)

EMBL: CP001349.PE505

CP001349.PE505       Location/Qualifiers
FT   CDS             583638..584741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0516"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1614
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55557"
FT                   /db_xref="GOA:B8ICG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55557.1"
FT                   /translation="MANYILRRLLLMIPTILGIMLISFVIVQFAPGGPVERVLAQLQGQ
FT                   NTAMSRVSGSSGDLGAPASGPRGGGETNSRYRGAQGLDPAFIKRLEQQFGFDKPAHERF
FT                   AKMIWDYARFDFGKSYFRDVSVLQLIREKLPVSITLGLWMTLISYAVSIPLGIRKAVRD
FT                   GSPFDVWTSGVVIVGYAIPGFLFAILLIVLFSGGSFLQIFPLRGLTSEGWQSFPLWQKV
FT                   TDYLWHITLPILSMALGAFATSTLLTKNSFLDEIRKQYVLTARMKGLSERQVLYGHVFR
FT                   NAMLIVVAGFPGAFISAFFAGSLLIETIFSLDGLGLLSFESIVNRDYPVVFANLYIFSL
FT                   LGLVVNLISDLTYSWIDPRIDFESRAA"
     MANYILRRLL LMIPTILGIM LISFVIVQFA PGGPVERVLA QLQGQNTAMS RVSGSSGDLG        60
     APASGPRGGG ETNSRYRGAQ GLDPAFIKRL EQQFGFDKPA HERFAKMIWD YARFDFGKSY       120
     FRDVSVLQLI REKLPVSITL GLWMTLISYA VSIPLGIRKA VRDGSPFDVW TSGVVIVGYA       180
     IPGFLFAILL IVLFSGGSFL QIFPLRGLTS EGWQSFPLWQ KVTDYLWHIT LPILSMALGA       240
     FATSTLLTKN SFLDEIRKQY VLTARMKGLS ERQVLYGHVF RNAMLIVVAG FPGAFISAFF       300
     AGSLLIETIF SLDGLGLLSF ESIVNRDYPV VFANLYIFSL LGLVVNLISD LTYSWIDPRI       360
     DFESRAA                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page