(data stored in ACNUC7421 zone)

EMBL: CP001349.PE506

CP001349.PE506       Location/Qualifiers
FT   CDS             complement(584824..585378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55558"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH0"
FT                   /inference="similar to AA sequence:KEGG:M446_2034"
FT                   /protein_id="ACL55558.1"
FT                   /translation="MAHERTASVFFFAPFVSSTMAVEPDWIDYNGHLNMAYYHVLFDRA
FT                   VDEAFGIVGLGPDYVVERQASYFAAEVHVRYRRELTRDDRVRVTLQLIDFDEKRLHFYS
FT                   EIRHAQDGWVAASSENMSLHVDATTRRVSSFPDDIMANLAVMKASHARLPRPDDLGRVM
FT                   SIPCRGRGQNGPVALTAGTRH"
     MAHERTASVF FFAPFVSSTM AVEPDWIDYN GHLNMAYYHV LFDRAVDEAF GIVGLGPDYV        60
     VERQASYFAA EVHVRYRREL TRDDRVRVTL QLIDFDEKRL HFYSEIRHAQ DGWVAASSEN       120
     MSLHVDATTR RVSSFPDDIM ANLAVMKASH ARLPRPDDLG RVMSIPCRGR GQNGPVALTA       180
     GTRH                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page