(data stored in ACNUC7421 zone)

EMBL: CP001349.PE507

CP001349.PE507       Location/Qualifiers
FT   CDS             585637..587055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0518"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   met:M446_2035 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55559"
FT                   /db_xref="GOA:B8ICH1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH1"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACL55559.1"
FT                   /translation="MNAPSPAPLRERPSQETVAAVTAALAARFGNRLVTSQAVREQHGS
FT                   TLTWVPNQPPDAVVFAQSTEEVQEIVRICAAHRMPVVAFGTGTSLEGHVNAPFGGVSVD
FT                   LSQMNRVLAVHAEDLDCVVQPGVTRKALNEHLRDQGLFFPIDPGADASLGGMAATRASG
FT                   TNAVRYGTMKDNVLALTAVLPSGEIVRTGSRARKSSAGYDLTRLLVGSEGTLGIITELT
FT                   LRLSGIPEAISAGICPFPTIKAACDAVIMTIQSGLPVARIELLDEVQVAACNAHSKLTL
FT                   PETPLLLVEFHGSEAGVAEQAERFGEITAEFGGGPYEWATKAEERSRLWQARHDVYWAA
FT                   SGMRPGAKVIATDVCVPISRLAECVDETKRDIVASGIVAPIAGHVGDGNFHTSPLVMMD
FT                   DPDEIARVTAFIERLVARAIAMEGTCTGEHGIGQKKMRFMEIEHGSAALELMRSLKRTI
FT                   DPDNIMNPGKVLAV"
     MNAPSPAPLR ERPSQETVAA VTAALAARFG NRLVTSQAVR EQHGSTLTWV PNQPPDAVVF        60
     AQSTEEVQEI VRICAAHRMP VVAFGTGTSL EGHVNAPFGG VSVDLSQMNR VLAVHAEDLD       120
     CVVQPGVTRK ALNEHLRDQG LFFPIDPGAD ASLGGMAATR ASGTNAVRYG TMKDNVLALT       180
     AVLPSGEIVR TGSRARKSSA GYDLTRLLVG SEGTLGIITE LTLRLSGIPE AISAGICPFP       240
     TIKAACDAVI MTIQSGLPVA RIELLDEVQV AACNAHSKLT LPETPLLLVE FHGSEAGVAE       300
     QAERFGEITA EFGGGPYEWA TKAEERSRLW QARHDVYWAA SGMRPGAKVI ATDVCVPISR       360
     LAECVDETKR DIVASGIVAP IAGHVGDGNF HTSPLVMMDD PDEIARVTAF IERLVARAIA       420
     MEGTCTGEHG IGQKKMRFME IEHGSAALEL MRSLKRTIDP DNIMNPGKVL AV               472
//

If you have problems or comments...

PBIL Back to PBIL home page