(data stored in ACNUC7421 zone)

EMBL: CP001349.PE508

CP001349.PE508       Location/Qualifiers
FT   CDS             complement(587088..588479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0519"
FT                   /product="TRAP-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: met:M446_2036 TRAP-type uncharacterized
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55560"
FT                   /db_xref="GOA:B8ICH2"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH2"
FT                   /inference="similar to AA sequence:KEGG:M446_2036"
FT                   /protein_id="ACL55560.1"
FT                   /translation="MPTILHRRDTLLLTGGLLLLALAALVLVLTRPTTLRVAVGPRDGV
FT                   EARLIEAYAEALARGQEDIRLKVVPFDDVRDSAAALQAGQADLAVVRPDVRLPENGLTL
FT                   AVLQDEALVVAAPAAAGITAFHELTGKRLGLVAHHGADQPFVTSLLTYYDLAQAPAERA
FT                   GAPGTVTLVPLRAEEITAALTSGRIDAVAVIAAPSSRRAGHVVRAVEAAAPDRSAVLVA
FT                   IPDGEAIIQRLPELQAMTIPAGTFGGRPKRPEEEVRTVGASYRLMARASLDRDTAARVT
FT                   QHLFELRSRLAARTTTANLMKAPDFDSSVAATSARLPNHPGAVDYFEREQQTFLQRYED
FT                   WIYLVAFFGGGLGSAGAWLGQRFAREKRARIDAVLDRLLSILSEARTAPDAATLDALAI
FT                   EIDGLVVDVVGHARSHATDIRTMSALILAVDAARAAVADCRRARDDGSARERIARVLTL
FT                   HAPGA"
     MPTILHRRDT LLLTGGLLLL ALAALVLVLT RPTTLRVAVG PRDGVEARLI EAYAEALARG        60
     QEDIRLKVVP FDDVRDSAAA LQAGQADLAV VRPDVRLPEN GLTLAVLQDE ALVVAAPAAA       120
     GITAFHELTG KRLGLVAHHG ADQPFVTSLL TYYDLAQAPA ERAGAPGTVT LVPLRAEEIT       180
     AALTSGRIDA VAVIAAPSSR RAGHVVRAVE AAAPDRSAVL VAIPDGEAII QRLPELQAMT       240
     IPAGTFGGRP KRPEEEVRTV GASYRLMARA SLDRDTAARV TQHLFELRSR LAARTTTANL       300
     MKAPDFDSSV AATSARLPNH PGAVDYFERE QQTFLQRYED WIYLVAFFGG GLGSAGAWLG       360
     QRFAREKRAR IDAVLDRLLS ILSEARTAPD AATLDALAIE IDGLVVDVVG HARSHATDIR       420
     TMSALILAVD AARAAVADCR RARDDGSARE RIARVLTLHA PGA                         463
//

If you have problems or comments...

PBIL Back to PBIL home page