(data stored in ACNUC7421 zone)

EMBL: CP001349.PE509

CP001349.PE509       Location/Qualifiers
FT   CDS             588495..589115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0520"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: met:M446_2037
FT                   regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55561"
FT                   /db_xref="GOA:B8ICH3"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH3"
FT                   /inference="protein motif:PFAM:PF02631"
FT                   /protein_id="ACL55561.1"
FT                   /translation="MRVKTIEDASAIPAAHEDADRHGGMTALPISAASLERAALAYLER
FT                   YGASTDMLRRVLLRRVAGRCRLRGEDPADFAALVEAVVAKAGRAGLVDDTIFADAKVRT
FT                   LRRRGGSARAIHAKLAAKGVDRETVQAALAAHEADRGEDDEAAAARAYARRRRLGPWRR
FT                   AEERAEARMRDLAAMARAGFAPSLARRVIDGEGETGAAAPDRE"
     MRVKTIEDAS AIPAAHEDAD RHGGMTALPI SAASLERAAL AYLERYGAST DMLRRVLLRR        60
     VAGRCRLRGE DPADFAALVE AVVAKAGRAG LVDDTIFADA KVRTLRRRGG SARAIHAKLA       120
     AKGVDRETVQ AALAAHEADR GEDDEAAAAR AYARRRRLGP WRRAEERAEA RMRDLAAMAR       180
     AGFAPSLARR VIDGEGETGA AAPDRE                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page