(data stored in ACNUC7421 zone)

EMBL: CP001349.PE51

CP001349.PE51        Location/Qualifiers
FT   CDS             complement(58350..58955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0052"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   met:M446_0052 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55103"
FT                   /db_xref="GOA:B8IU58"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU58"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACL55103.1"
FT                   /translation="MILVIDNYDSFVFNVVRYFEELGAAVEVVRNDALDVRAIRARAPE
FT                   ALVISPGPCTPAEAGVSLEAVRALSGELPLLGVCLGHQCIGAAFGGRVERAGRPLHGQA
FT                   SPVTHDGRGLFRGLPSPMRVGRYHSLIVAPEPAMERILSVDAVSAEGEVMALSHRRHPT
FT                   FGIQFHPESVLTENGHAIFANFLALARAWREAPAHAVA"
     MILVIDNYDS FVFNVVRYFE ELGAAVEVVR NDALDVRAIR ARAPEALVIS PGPCTPAEAG        60
     VSLEAVRALS GELPLLGVCL GHQCIGAAFG GRVERAGRPL HGQASPVTHD GRGLFRGLPS       120
     PMRVGRYHSL IVAPEPAMER ILSVDAVSAE GEVMALSHRR HPTFGIQFHP ESVLTENGHA       180
     IFANFLALAR AWREAPAHAV A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page