(data stored in ACNUC7421 zone)

EMBL: CP001349.PE510

CP001349.PE510       Location/Qualifiers
FT   CDS             complement(589181..589444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55562"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH4"
FT                   /inference="similar to AA sequence:KEGG:M446_2038"
FT                   /protein_id="ACL55562.1"
FT                   /translation="MTGSERPTLGELFRIKAVTDHDLSAAVAAYFADPTPGPREIARGI
FT                   RIDVAAAVAAHDWARRIVEDEAIIERARRNAVRTAILHARPM"
     MTGSERPTLG ELFRIKAVTD HDLSAAVAAY FADPTPGPRE IARGIRIDVA AAVAAHDWAR        60
     RIVEDEAIIE RARRNAVRTA ILHARPM                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page