(data stored in ACNUC7421 zone)

EMBL: CP001349.PE512

CP001349.PE512       Location/Qualifiers
FT   CDS             complement(590209..590736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0523"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   mex:Mext_1108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55564"
FT                   /db_xref="GOA:B8ICH6"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH6"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ACL55564.1"
FT                   /translation="MPDWRALFVPEHSLVEIALRGTIMYLALFVILRFVMQRQAGAVGL
FT                   ADLLVIVLIADVSQNAFSNEYKSLTEGVLLVLTIVGWNYGIDWLGYRFPAFERFITPRR
FT                   LPLVVDGEICWRNMRREMITHAELMSQLRQQGIEDPAMVRIASIEGDGRISVIRRDDDD
FT                   TGRDGDKRREVA"
     MPDWRALFVP EHSLVEIALR GTIMYLALFV ILRFVMQRQA GAVGLADLLV IVLIADVSQN        60
     AFSNEYKSLT EGVLLVLTIV GWNYGIDWLG YRFPAFERFI TPRRLPLVVD GEICWRNMRR       120
     EMITHAELMS QLRQQGIEDP AMVRIASIEG DGRISVIRRD DDDTGRDGDK RREVA            175
//

If you have problems or comments...

PBIL Back to PBIL home page