(data stored in ACNUC7421 zone)

EMBL: CP001349.PE513

CP001349.PE513       Location/Qualifiers
FT   CDS             complement(591063..591482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55565"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH7"
FT                   /inference="similar to AA sequence:KEGG:M446_1067"
FT                   /protein_id="ACL55565.1"
FT                   /translation="MPIDLPREPFPPAVPFTSRLKLFATDMRLGVTGWRLDQARRRRDH
FT                   RGLLRHLEVWTTLQDRRAVYLGQRLPLAADRARDETCRRIRGIVHRIDRETRRLEWATG
FT                   RMQRAYLAQDQRAFSHAELLGQLACQRLQRLWTSL"
     MPIDLPREPF PPAVPFTSRL KLFATDMRLG VTGWRLDQAR RRRDHRGLLR HLEVWTTLQD        60
     RRAVYLGQRL PLAADRARDE TCRRIRGIVH RIDRETRRLE WATGRMQRAY LAQDQRAFSH       120
     AELLGQLACQ RLQRLWTSL                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page