(data stored in ACNUC7421 zone)

EMBL: CP001349.PE515

CP001349.PE515       Location/Qualifiers
FT   CDS             complement(591959..592090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55567"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH9"
FT                   /inference="similar to AA sequence:KEGG:M446_6412"
FT                   /protein_id="ACL55567.1"
FT                   /translation="MRVIGVSLALLPIVVVLLVSSILRGLTLPFRALLALRRGAAKA"
     MRVIGVSLAL LPIVVVLLVS SILRGLTLPF RALLALRRGA AKA                          43
//

If you have problems or comments...

PBIL Back to PBIL home page