(data stored in ACNUC7421 zone)

EMBL: CP001349.PE516

CP001349.PE516       Location/Qualifiers
FT   CDS             592994..594106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0527"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: met:M446_3557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55568"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI0"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACL55568.1"
FT                   /translation="MRGELHASPGQSNRLVSSFTVVCLSACLLADPVAAQDPSDPSGSP
FT                   VSATKSDSVAGGSLSMATIRVPQGERIVLPITNASTQNRNFRSIYMVGLPPGAMVSDNI
FT                   HDATITSESRTLDVSNWNLEGISLLLPDDIASRFPDPIVTSIVAILPRSEKAGSIRTET
FT                   LSTTVIIPEIKATKSPETVSTQPSAQPDNPPPPALTPQPASQPTPKDDKPETPWLNPKS
FT                   AEGKPKPDNTGEPTSAQLKQAPSTAEKTRDTAQDQATASSQAPDTAAQAGPTTARDAGE
FT                   SALAKSLTQRAQQALRLGNVSGARLLLQRAASSGDAEATFMLAQTYDESFLRHLGVRGL
FT                   KADPEQARTYYDAAARAGYAGIQRQAKSGR"
     MRGELHASPG QSNRLVSSFT VVCLSACLLA DPVAAQDPSD PSGSPVSATK SDSVAGGSLS        60
     MATIRVPQGE RIVLPITNAS TQNRNFRSIY MVGLPPGAMV SDNIHDATIT SESRTLDVSN       120
     WNLEGISLLL PDDIASRFPD PIVTSIVAIL PRSEKAGSIR TETLSTTVII PEIKATKSPE       180
     TVSTQPSAQP DNPPPPALTP QPASQPTPKD DKPETPWLNP KSAEGKPKPD NTGEPTSAQL       240
     KQAPSTAEKT RDTAQDQATA SSQAPDTAAQ AGPTTARDAG ESALAKSLTQ RAQQALRLGN       300
     VSGARLLLQR AASSGDAEAT FMLAQTYDES FLRHLGVRGL KADPEQARTY YDAAARAGYA       360
     GIQRQAKSGR                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page