(data stored in ACNUC7421 zone)

EMBL: CP001349.PE517

CP001349.PE517       Location/Qualifiers
FT   CDS             594136..595299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55569"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI1"
FT                   /inference="similar to AA sequence:KEGG:M446_3556"
FT                   /protein_id="ACL55569.1"
FT                   /translation="MDRKRARIFTTAALCVLSIGWTAGSVAVARDQTQSSNSATASDKL
FT                   ETEAAITDHMNSSTVSIITGTPGGTYFRIGADLAFVLDDDSKLRILPILGKGAGQNAYD
FT                   LRFLKGVDLAFLRTDTLEQLRQDKRLSRIEYHIHYIAKLFDDELHVIGPNDITDARQLA
FT                   GKKVTFDVKGSGTDYSGKAMFRNLGISVQAINVDQPTAFEMLRKGEVDAVVSVAAKPVA
FT                   VVANFDPADKFHLIPVKYSESINESYAPASISKKDYPKLIKDDGQVETLAVGTVLGVYN
FT                   HPKGSFRYKKLSRFVESFFSRFDEFLSPQRHPKWREVNLAAEVSGWTRFRPAQDWLDSQ
FT                   REHQVSSNDNLTKFLNEQQPGAATDKEELYQAYLKWRNARRNTTSGL"
     MDRKRARIFT TAALCVLSIG WTAGSVAVAR DQTQSSNSAT ASDKLETEAA ITDHMNSSTV        60
     SIITGTPGGT YFRIGADLAF VLDDDSKLRI LPILGKGAGQ NAYDLRFLKG VDLAFLRTDT       120
     LEQLRQDKRL SRIEYHIHYI AKLFDDELHV IGPNDITDAR QLAGKKVTFD VKGSGTDYSG       180
     KAMFRNLGIS VQAINVDQPT AFEMLRKGEV DAVVSVAAKP VAVVANFDPA DKFHLIPVKY       240
     SESINESYAP ASISKKDYPK LIKDDGQVET LAVGTVLGVY NHPKGSFRYK KLSRFVESFF       300
     SRFDEFLSPQ RHPKWREVNL AAEVSGWTRF RPAQDWLDSQ REHQVSSNDN LTKFLNEQQP       360
     GAATDKEELY QAYLKWRNAR RNTTSGL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page