(data stored in ACNUC7421 zone)

EMBL: CP001349.PE518

CP001349.PE518       Location/Qualifiers
FT   CDS             complement(595715..596212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55570"
FT                   /db_xref="GOA:B8ICI2"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI2"
FT                   /inference="similar to AA sequence:KEGG:M446_0955"
FT                   /protein_id="ACL55570.1"
FT                   /translation="MTAPPVPAHPKQDKAALLAAFYGYLGGRIDSVARRSSLLMAFLAS
FT                   FLGFAMSPLMKRDAASVSEKVEFVLSHPSLLIGVAGMIILLWSDLARVRRADDLFSRIA
FT                   FSDLDIGSLQDRYVGSQIDDLFRQMIANTRVVGEFLKRKIRLYNAGAILFAVSVSLYVI
FT                   GL"
     MTAPPVPAHP KQDKAALLAA FYGYLGGRID SVARRSSLLM AFLASFLGFA MSPLMKRDAA        60
     SVSEKVEFVL SHPSLLIGVA GMIILLWSDL ARVRRADDLF SRIAFSDLDI GSLQDRYVGS       120
     QIDDLFRQMI ANTRVVGEFL KRKIRLYNAG AILFAVSVSL YVIGL                       165
//

If you have problems or comments...

PBIL Back to PBIL home page