(data stored in ACNUC7421 zone)

EMBL: CP001349.PE519

CP001349.PE519       Location/Qualifiers
FT   CDS             complement(596261..597574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0531"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mrd:Mrad2831_2892 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55571"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL55571.1"
FT                   /translation="MAVSMRRRSFLGGLAVSGVIGAGHLDVFARAWAETAEWKPEPNAS
FT                   LSLLRWKRFVPSEDEAFMRLVDAFIKATGVRISVTNESYDDIQPKASVAANTGQGPDLV
FT                   WGLYSFPALFPSKCLPVDDVAASLERKYGPWLPAAAAYGRIKGRWLAIPVAFTGSGINY
FT                   RISSLKKAGFSSFPANTEEFLELCKGLKRNNTPAGMALGHATGDANSWLHWALWAHGGG
FT                   LVDRNEKIVINSPETTKSLEYVKALYETFIPGTVSWNDSSNNKAFLAGDLHLTVNGVSI
FT                   YATAKTDNPRIAEDMDHAPLPIGPAGKPTEFTLAFPILAYTYTKAPNACKAFMAFMMDA
FT                   ANYCPWLNDAQGYLVEPLSAYPANPVWAKDPKLGAIAGGVKRSLAAGGSAPVSERIAAA
FT                   LAEFIVVDMYAGYCTGREDVRGAMRMAERSAQRIFRNA"
     MAVSMRRRSF LGGLAVSGVI GAGHLDVFAR AWAETAEWKP EPNASLSLLR WKRFVPSEDE        60
     AFMRLVDAFI KATGVRISVT NESYDDIQPK ASVAANTGQG PDLVWGLYSF PALFPSKCLP       120
     VDDVAASLER KYGPWLPAAA AYGRIKGRWL AIPVAFTGSG INYRISSLKK AGFSSFPANT       180
     EEFLELCKGL KRNNTPAGMA LGHATGDANS WLHWALWAHG GGLVDRNEKI VINSPETTKS       240
     LEYVKALYET FIPGTVSWND SSNNKAFLAG DLHLTVNGVS IYATAKTDNP RIAEDMDHAP       300
     LPIGPAGKPT EFTLAFPILA YTYTKAPNAC KAFMAFMMDA ANYCPWLNDA QGYLVEPLSA       360
     YPANPVWAKD PKLGAIAGGV KRSLAAGGSA PVSERIAAAL AEFIVVDMYA GYCTGREDVR       420
     GAMRMAERSA QRIFRNA                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page