(data stored in ACNUC7421 zone)

EMBL: CP001349.PE52

CP001349.PE52        Location/Qualifiers
FT   CDS             complement(59059..60453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0053"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Anthranilate synthase component I domain protein;
FT                   Chorismate binding-like; KEGG: met:M446_0053
FT                   para-aminobenzoate synthase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55104"
FT                   /db_xref="GOA:B8IU59"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU59"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ACL55104.1"
FT                   /translation="MWTRPIPFLDPIAAAARLQGRPGLAFLDSAMRHPELGRYSYLAAD
FT                   PFLRFEVRGGRAFRDGAPLEGAPLAALRRLLAPYRAEPLPGLPPFQGGAIGYLAYDFGQ
FT                   SLERVAVPPRRASLCDDIALNLYGTLVAWDHREETCHLVATGFPETRGPARERHALACL
FT                   DAWEALLAGPEPVARPRSVPPLAWRSNFSAESYAAAVERVRAYIRAGDIYQANIAQRFT
FT                   AALPPGFDAFAFYRRLRARNAATFAAYLDFGRLKVASSSPERFLRLDGRQVETRPIKGT
FT                   APRSPDPAEDRARAEALLASDKERAENVMIVDLLRNDLSRICEPHSVSVPTLCGLETYA
FT                   GVHHLVSVVTGRLRAGADALDLLAATFPGGSITGAPKLRAMDIITEIEGDARELYCGNI
FT                   GWIGFDGRMDTNIAIRTVFMDEREAVLQAGGGITLLSDPVAEYEETLTKAERIFAAFTE
FT                   AAGDPT"
     MWTRPIPFLD PIAAAARLQG RPGLAFLDSA MRHPELGRYS YLAADPFLRF EVRGGRAFRD        60
     GAPLEGAPLA ALRRLLAPYR AEPLPGLPPF QGGAIGYLAY DFGQSLERVA VPPRRASLCD       120
     DIALNLYGTL VAWDHREETC HLVATGFPET RGPARERHAL ACLDAWEALL AGPEPVARPR       180
     SVPPLAWRSN FSAESYAAAV ERVRAYIRAG DIYQANIAQR FTAALPPGFD AFAFYRRLRA       240
     RNAATFAAYL DFGRLKVASS SPERFLRLDG RQVETRPIKG TAPRSPDPAE DRARAEALLA       300
     SDKERAENVM IVDLLRNDLS RICEPHSVSV PTLCGLETYA GVHHLVSVVT GRLRAGADAL       360
     DLLAATFPGG SITGAPKLRA MDIITEIEGD ARELYCGNIG WIGFDGRMDT NIAIRTVFMD       420
     EREAVLQAGG GITLLSDPVA EYEETLTKAE RIFAAFTEAA GDPT                        464
//

If you have problems or comments...

PBIL Back to PBIL home page