(data stored in ACNUC7421 zone)

EMBL: CP001349.PE520

CP001349.PE520       Location/Qualifiers
FT   CDS             complement(597763..600867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0532"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bja:blr0277 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55572"
FT                   /db_xref="GOA:B8ICI4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI4"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACL55572.1"
FT                   /translation="MNLSAGFITRPIATALLMVAIVVLGAISYTLLPVAALPNIDTPTI
FT                   QVTAQLPGADPSTVASSVATQLERQFGQIPGLTQMTSSSGTGFTQITLQFDRSRTVDSA
FT                   AGDVQAAINATQGQLPAALLNPPTYHKTNPADTPILLIALTSDVLPIMTVSDYANSILA
FT                   QKISQIPGVGFVGVGGLQSPALRIQVNPAQLAAENLDFETVRSALANLTVLQPKGQLYG
FT                   PQQAVALQTNDQLMTVSGFEDAIVAYRNGAPIRVRDIGRVVKAPQDTTLAGWLNEKPAV
FT                   LLAVQRQPGANVTSTVAAIKAALPQLRASLPPGIQVEMVSDRTQTIQASLADVQFTLLL
FT                   TIALVVGVIALFLRKLWATVIPAIAVPISLVGTFAVMDALGYSLDNLSLMALTIAIGFV
FT                   VDDAIVMVENIVRHIEEGAAPLQAALKGAGEIGFTILSISISLIAVFIPFFLMGGVVGL
FT                   LFREFAVTVAVSILVSVVVSLTLTPMLCARLLPAGEGSPGRMSRLLEDFFTWLTRAYGR
FT                   GLRVALRHRFLTLMSFLATVALTGYLFVIIPKGFFPQQDTGLIIGISEAAQDVSPQGMR
FT                   QRQEAILAIASRDPAVASAVGYIGPGGPTVTENNGRVFITLKPEGERDVTADQVIVRLG
FT                   KALEQVQGITLYMQAAQDITIGSRLSKTQYQYTLTDVNLDELNLYAPKLLEALRRLPEL
FT                   TAVASDQQSTARTLTVEIDRAAASRLGIDPSLVDATLYDAFGQRHVARIYTALNQYYAI
FT                   LEVAPSYQLGPAALNRIYVRSQSGTSVPISQIARLVPGVAPAAVNHQGQFPSVTLSFNL
FT                   APGATIGAAVAAVQKATVDLHLPPSIATSFQGNAQAFQSSLGSTPPLILAALFAVYVIL
FT                   GMLYESTIHPLTILSTLPSAGLGALATLMLFGRPLDLIGIIGIILLIGIVKKNGIMLVD
FT                   VAIDAERHGHASAEEAIYDACLLRFRPILMTTMCALLGGVPLMLGTGTGSEIRQPLGYA
FT                   IVGGLLVSQALTLFTTPVVYLSMDRLSGALASLWGRKQASGIEPA"
     MNLSAGFITR PIATALLMVA IVVLGAISYT LLPVAALPNI DTPTIQVTAQ LPGADPSTVA        60
     SSVATQLERQ FGQIPGLTQM TSSSGTGFTQ ITLQFDRSRT VDSAAGDVQA AINATQGQLP       120
     AALLNPPTYH KTNPADTPIL LIALTSDVLP IMTVSDYANS ILAQKISQIP GVGFVGVGGL       180
     QSPALRIQVN PAQLAAENLD FETVRSALAN LTVLQPKGQL YGPQQAVALQ TNDQLMTVSG       240
     FEDAIVAYRN GAPIRVRDIG RVVKAPQDTT LAGWLNEKPA VLLAVQRQPG ANVTSTVAAI       300
     KAALPQLRAS LPPGIQVEMV SDRTQTIQAS LADVQFTLLL TIALVVGVIA LFLRKLWATV       360
     IPAIAVPISL VGTFAVMDAL GYSLDNLSLM ALTIAIGFVV DDAIVMVENI VRHIEEGAAP       420
     LQAALKGAGE IGFTILSISI SLIAVFIPFF LMGGVVGLLF REFAVTVAVS ILVSVVVSLT       480
     LTPMLCARLL PAGEGSPGRM SRLLEDFFTW LTRAYGRGLR VALRHRFLTL MSFLATVALT       540
     GYLFVIIPKG FFPQQDTGLI IGISEAAQDV SPQGMRQRQE AILAIASRDP AVASAVGYIG       600
     PGGPTVTENN GRVFITLKPE GERDVTADQV IVRLGKALEQ VQGITLYMQA AQDITIGSRL       660
     SKTQYQYTLT DVNLDELNLY APKLLEALRR LPELTAVASD QQSTARTLTV EIDRAAASRL       720
     GIDPSLVDAT LYDAFGQRHV ARIYTALNQY YAILEVAPSY QLGPAALNRI YVRSQSGTSV       780
     PISQIARLVP GVAPAAVNHQ GQFPSVTLSF NLAPGATIGA AVAAVQKATV DLHLPPSIAT       840
     SFQGNAQAFQ SSLGSTPPLI LAALFAVYVI LGMLYESTIH PLTILSTLPS AGLGALATLM       900
     LFGRPLDLIG IIGIILLIGI VKKNGIMLVD VAIDAERHGH ASAEEAIYDA CLLRFRPILM       960
     TTMCALLGGV PLMLGTGTGS EIRQPLGYAI VGGLLVSQAL TLFTTPVVYL SMDRLSGALA      1020
     SLWGRKQASG IEPA                                                        1034
//

If you have problems or comments...

PBIL Back to PBIL home page