(data stored in ACNUC7421 zone)

EMBL: CP001349.PE521

CP001349.PE521       Location/Qualifiers
FT   CDS             complement(600864..602009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0533"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bja:blr0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55573"
FT                   /db_xref="GOA:B8ICI5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI5"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACL55573.1"
FT                   /translation="MLVASLTLAAVGFAAELHLAGQQHQIQPAPPSPVPVVIATVQQHD
FT                   VPLVLSGVGTVQALNAATVRTQVTGILENVEFTEGQFVKRGDVLATIDPRIYQAQLDQA
FT                   RAQLARDQALLTNQETNLRRDEPLLQRGFATDQQVVTERAQIAQTQSTLRADQALIDNA
FT                   ATQFDFATLRAPFDGVTGVRLIDVGNVVHPTDPTGIVVLTQVQPISVIFTLPSADIPAV
FT                   QEALARGPVQTAIYDQSGTRQLDTGTLLLINNQADPNSGTVQLKATFPNAHRQLWPGTF
FT                   VNAQVITSVGRGALTIPTDAVQQNDRGQYVFVVGPDRTVSMRPVRVAQRVRGTALIASG
FT                   LTAGESVVVQGQYRLTPGTAVVSAPASEVPNTTTASAGMLP"
     MLVASLTLAA VGFAAELHLA GQQHQIQPAP PSPVPVVIAT VQQHDVPLVL SGVGTVQALN        60
     AATVRTQVTG ILENVEFTEG QFVKRGDVLA TIDPRIYQAQ LDQARAQLAR DQALLTNQET       120
     NLRRDEPLLQ RGFATDQQVV TERAQIAQTQ STLRADQALI DNAATQFDFA TLRAPFDGVT       180
     GVRLIDVGNV VHPTDPTGIV VLTQVQPISV IFTLPSADIP AVQEALARGP VQTAIYDQSG       240
     TRQLDTGTLL LINNQADPNS GTVQLKATFP NAHRQLWPGT FVNAQVITSV GRGALTIPTD       300
     AVQQNDRGQY VFVVGPDRTV SMRPVRVAQR VRGTALIASG LTAGESVVVQ GQYRLTPGTA       360
     VVSAPASEVP NTTTASAGML P                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page