(data stored in ACNUC7421 zone)

EMBL: CP001349.PE522

CP001349.PE522       Location/Qualifiers
FT   CDS             602629..603297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55574"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55574.1"
FT                   /translation="MTRPSERPGDSQHDAAQPCVCGDIVEPAVPQHGRLQSRRYEWQLK
FT                   HLKWRHARKLTGRALSEHGEHVGLCQYGGGCKQWGSQRDVPLQAMAGQLDIDELSAFAR
FT                   RGHDQVGEGSECIEIESFVPLGRVPTPQENRESAVEEPTVCEPLARRSEATECEINLTA
FT                   VESLGKVDGTAWAQIETNTRSLCGDGGCKRRREDQRRAIVDRNRETTLGSIRVELRRTF
FT                   "
     MTRPSERPGD SQHDAAQPCV CGDIVEPAVP QHGRLQSRRY EWQLKHLKWR HARKLTGRAL        60
     SEHGEHVGLC QYGGGCKQWG SQRDVPLQAM AGQLDIDELS AFARRGHDQV GEGSECIEIE       120
     SFVPLGRVPT PQENRESAVE EPTVCEPLAR RSEATECEIN LTAVESLGKV DGTAWAQIET       180
     NTRSLCGDGG CKRRREDQRR AIVDRNRETT LGSIRVELRR TF                          222
//

If you have problems or comments...

PBIL Back to PBIL home page