(data stored in ACNUC7421 zone)

EMBL: CP001349.PE523

CP001349.PE523       Location/Qualifiers
FT   CDS             604133..605008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0536"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mex:Mext_4689
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55575"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL55575.1"
FT                   /translation="MTELNPSGTFAIGGDLVVHRLGFGAMRITGPGIWGEPASREAAIA
FT                   TLRRVPELGVDLIDTADSYGPFVSEDLIREVLHPYTGLVIATKGGLTRHGPDIWRPVGN
FT                   PDYLRQCVLMSLRRLGLERIDLWQLHRIGPDCPREVQFEAIARMRDEGLIRHVGLSEVS
FT                   IDDIQAAQRFFPVAAVQNRYNLVDRTSEAVLDYCESAGIGFIPWAPLDRGALARYGSAI
FT                   AQAAARHSVGEGAIALAWLLKRSPVMLPIPGTGDPEHLAENMRGATVELTSEEFNALDQ
FT                   EGRAAWQAAR"
     MTELNPSGTF AIGGDLVVHR LGFGAMRITG PGIWGEPASR EAAIATLRRV PELGVDLIDT        60
     ADSYGPFVSE DLIREVLHPY TGLVIATKGG LTRHGPDIWR PVGNPDYLRQ CVLMSLRRLG       120
     LERIDLWQLH RIGPDCPREV QFEAIARMRD EGLIRHVGLS EVSIDDIQAA QRFFPVAAVQ       180
     NRYNLVDRTS EAVLDYCESA GIGFIPWAPL DRGALARYGS AIAQAAARHS VGEGAIALAW       240
     LLKRSPVMLP IPGTGDPEHL AENMRGATVE LTSEEFNALD QEGRAAWQAA R                291
//

If you have problems or comments...

PBIL Back to PBIL home page