(data stored in ACNUC7421 zone)

EMBL: CP001349.PE528

CP001349.PE528       Location/Qualifiers
FT   CDS             complement(609625..611337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0542"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rpt:Rpal_3326 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55580"
FT                   /db_xref="GOA:B8IDK8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK8"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACL55580.1"
FT                   /translation="MAASMALGVAPWGLSAGRIADPLTVTVLPNCKRLVKSMVATVPEI
FT                   KFPEIIIGIVAPIGAEVNACVREFVKYFKKAEYEVVEIKVTDVFRKLKNYIEPTTNLEE
FT                   APLFVRYDIYTSYGNQLRSEFSDDILAATSLGRIVKSRPNLPRQHGQRAFERVVYIVHQ
FT                   FKRKEEIDLFRAVYGRLFFQVSVYSRRGARVDYLAQRFANSDNSANPNMYRYHAENLVQ
FT                   RDENEKDEHGQKVSKVFHDADFIINSDIRSPSIENQIIRFCDLLFGSNSISPTKVEYGM
FT                   FIAKAAALRTLDLSRQVGAAIFTNNGEIVSMGSNEVPKGQGGTYWGDDGLDDREYVREH
FT                   DSNDRRKLEILSEITGILNLKIEDVMKIKGIRDSQFMDALEYGRIVHAEILAISDAARL
FT                   GRSTHDTVLYCTTFPCHMCAKHIVASGVKKVVFLEPYPKSLVADLHSDSISIENSDRGR
FT                   YEDFQAVDFEHFHGITPRRYRELFERGKRKDDNGKFRQWNKGNLPSPQPNLGVNVPFYQ
FT                   QIEKLIFEDYLGGQLKNKGIDPSVLDPETSGGESASTSSTDAPQDVSGKFLQL"
     MAASMALGVA PWGLSAGRIA DPLTVTVLPN CKRLVKSMVA TVPEIKFPEI IIGIVAPIGA        60
     EVNACVREFV KYFKKAEYEV VEIKVTDVFR KLKNYIEPTT NLEEAPLFVR YDIYTSYGNQ       120
     LRSEFSDDIL AATSLGRIVK SRPNLPRQHG QRAFERVVYI VHQFKRKEEI DLFRAVYGRL       180
     FFQVSVYSRR GARVDYLAQR FANSDNSANP NMYRYHAENL VQRDENEKDE HGQKVSKVFH       240
     DADFIINSDI RSPSIENQII RFCDLLFGSN SISPTKVEYG MFIAKAAALR TLDLSRQVGA       300
     AIFTNNGEIV SMGSNEVPKG QGGTYWGDDG LDDREYVREH DSNDRRKLEI LSEITGILNL       360
     KIEDVMKIKG IRDSQFMDAL EYGRIVHAEI LAISDAARLG RSTHDTVLYC TTFPCHMCAK       420
     HIVASGVKKV VFLEPYPKSL VADLHSDSIS IENSDRGRYE DFQAVDFEHF HGITPRRYRE       480
     LFERGKRKDD NGKFRQWNKG NLPSPQPNLG VNVPFYQQIE KLIFEDYLGG QLKNKGIDPS       540
     VLDPETSGGE SASTSSTDAP QDVSGKFLQL                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page