(data stored in ACNUC7421 zone)

EMBL: CP001349.PE529

CP001349.PE529       Location/Qualifiers
FT   CDS             611750..611902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55581"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK9"
FT                   /inference="similar to AA sequence:KEGG:M446_2886"
FT                   /protein_id="ACL55581.1"
FT                   /translation="MRLIAESVALDVAAVVLAHPYVREVLARESAPEAQRHNAVRTAIL
FT                   LARAA"
     MRLIAESVAL DVAAVVLAHP YVREVLARES APEAQRHNAV RTAILLARAA                   50
//

If you have problems or comments...

PBIL Back to PBIL home page