(data stored in ACNUC7421 zone)

EMBL: CP001349.PE53

CP001349.PE53        Location/Qualifiers
FT   CDS             complement(60575..61591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0054"
FT                   /product="putative periplasmic substrate-binding
FT                   transmembrane protein"
FT                   /note="KEGG: met:M446_0054 putative periplasmic
FT                   substrate-binding transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55105"
FT                   /db_xref="GOA:B8IU60"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU60"
FT                   /inference="similar to AA sequence:KEGG:M446_0054"
FT                   /protein_id="ACL55105.1"
FT                   /translation="MLGQKWLRLAAGAAIALGLATMPLRAEVSEVRISKGYGILYLPLF
FT                   VMQEKKFLEAQAAKAGLGDVKVTWLTLDGGNVINDAMIAGSLDIAGTGAPGFLALWSKG
FT                   RGSPKTEVIGVSGMSTTALDLNVNKAEIKSLADFTPKDKIAIPGIKTSLAAVVLQMAVA
FT                   KQFGPENYGKLDASTVGLPHPEAVAALLSGKTEIVAHFASPPFTQVERADPKIRTILKA
FT                   SEVFGPITLDVVFALKRFTEANPKLTQAFLDALDQANAFIQENKAETAEIFARASKVKV
FT                   TPEEVRPMLDDPDSRFSSTPTGIMEFATFMHRVGIIKTKPAAWTDLFIPALRERAGS"
     MLGQKWLRLA AGAAIALGLA TMPLRAEVSE VRISKGYGIL YLPLFVMQEK KFLEAQAAKA        60
     GLGDVKVTWL TLDGGNVIND AMIAGSLDIA GTGAPGFLAL WSKGRGSPKT EVIGVSGMST       120
     TALDLNVNKA EIKSLADFTP KDKIAIPGIK TSLAAVVLQM AVAKQFGPEN YGKLDASTVG       180
     LPHPEAVAAL LSGKTEIVAH FASPPFTQVE RADPKIRTIL KASEVFGPIT LDVVFALKRF       240
     TEANPKLTQA FLDALDQANA FIQENKAETA EIFARASKVK VTPEEVRPML DDPDSRFSST       300
     PTGIMEFATF MHRVGIIKTK PAAWTDLFIP ALRERAGS                               338
//

If you have problems or comments...

PBIL Back to PBIL home page