(data stored in ACNUC7421 zone)

EMBL: CP001349.PE530

CP001349.PE530       Location/Qualifiers
FT   CDS             611993..612391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55582"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL0"
FT                   /inference="similar to AA sequence:KEGG:mlr0242"
FT                   /protein_id="ACL55582.1"
FT                   /translation="MRVLLIGYDPDTVDFSDPALPPGLDAEKIHTGIALALKQMRERGW
FT                   KVDHCFIHPDATAAAAVKQQVMSETYDCIVIGAGVRLWSRHIAVFEAVINAVHKAAPQA
FT                   MIAFNTRPEDSADAAERWLPFSQDRPSS"
     MRVLLIGYDP DTVDFSDPAL PPGLDAEKIH TGIALALKQM RERGWKVDHC FIHPDATAAA        60
     AVKQQVMSET YDCIVIGAGV RLWSRHIAVF EAVINAVHKA APQAMIAFNT RPEDSADAAE       120
     RWLPFSQDRP SS                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page