(data stored in ACNUC7421 zone)

EMBL: CP001349.PE531

CP001349.PE531       Location/Qualifiers
FT   CDS             complement(613011..613421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0545"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: met:M446_6972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55583"
FT                   /db_xref="GOA:B8IDL1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL1"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL55583.1"
FT                   /translation="MAKCFHLALIQQLETAIPADVTDELRRRLRATVAEKPLGKQHVAQ
FT                   LMGIHRRTLARLLKSEGTSFKLVADETRLSIAKQLLADTNLSLAQISATLEFSEPAAFT
FT                   RAFRRRTGTTPSAGRKEHRRRHVARNVQTALG"
     MAKCFHLALI QQLETAIPAD VTDELRRRLR ATVAEKPLGK QHVAQLMGIH RRTLARLLKS        60
     EGTSFKLVAD ETRLSIAKQL LADTNLSLAQ ISATLEFSEP AAFTRAFRRR TGTTPSAGRK       120
     EHRRRHVARN VQTALG                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page