(data stored in ACNUC7421 zone)

EMBL: CP001349.PE533

CP001349.PE533       Location/Qualifiers
FT   CDS             613566..614345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55585"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55585.1"
FT                   /translation="MRSTTSASSSRGTGVSLRSNNVPLHKLFPSIYAIHIAHTHLVNAV
FT                   EVTPIVHRLSPPTSRLYRPSLAWRFREARKPMYGTRRARHGRTGRARHRGKARTSRVRL
FT                   PHEECDTQHLEAAMYSKRPSKLIFGTLLATPFISLVAVAEQCPQSGEESGPARPASPSV
FT                   LVRFSQWFIRHGITQERYTFHASGAYEYVRAAGETVRAWEDGSYTVKSDHLILSPEGGR
FT                   PRTICWRIGTYTGEGYRPILWLSTPDGREEHFSPTMP"
     MRSTTSASSS RGTGVSLRSN NVPLHKLFPS IYAIHIAHTH LVNAVEVTPI VHRLSPPTSR        60
     LYRPSLAWRF REARKPMYGT RRARHGRTGR ARHRGKARTS RVRLPHEECD TQHLEAAMYS       120
     KRPSKLIFGT LLATPFISLV AVAEQCPQSG EESGPARPAS PSVLVRFSQW FIRHGITQER       180
     YTFHASGAYE YVRAAGETVR AWEDGSYTVK SDHLILSPEG GRPRTICWRI GTYTGEGYRP       240
     ILWLSTPDGR EEHFSPTMP                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page