(data stored in ACNUC7421 zone)

EMBL: CP001349.PE535

CP001349.PE535       Location/Qualifiers
FT   CDS             615499..615942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0549"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_6603 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55587"
FT                   /db_xref="GOA:B8IDL5"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL5"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55587.1"
FT                   /translation="MPNDISITTANDASSLSTIAITADIVSAFLAHNQIPAASLPPLLT
FT                   SVHASLARLTKPAEPAPEPLVPPVPIKKTVTPDAIISLEDGKPYKTLARHLAGRGLTPE
FT                   QYRQKWGLPANYPMTAANYSSQRSELAKKSGLGQKAPSRKTGT"
     MPNDISITTA NDASSLSTIA ITADIVSAFL AHNQIPAASL PPLLTSVHAS LARLTKPAEP        60
     APEPLVPPVP IKKTVTPDAI ISLEDGKPYK TLARHLAGRG LTPEQYRQKW GLPANYPMTA       120
     ANYSSQRSEL AKKSGLGQKA PSRKTGT                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page