(data stored in ACNUC7421 zone)

EMBL: CP001349.PE536

CP001349.PE536       Location/Qualifiers
FT   CDS             616089..616337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55588"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL6"
FT                   /inference="similar to AA sequence:KEGG:M446_1863"
FT                   /protein_id="ACL55588.1"
FT                   /translation="MPIYLDDEWHAFLSDETRVKRVYRDEVLIGRVRRWQVSEPGELTR
FT                   EWYTAERCEGSLFVQIEGKQPDFEEALQRVVFYGVAH"
     MPIYLDDEWH AFLSDETRVK RVYRDEVLIG RVRRWQVSEP GELTREWYTA ERCEGSLFVQ        60
     IEGKQPDFEE ALQRVVFYGV AH                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page