(data stored in ACNUC7421 zone)

EMBL: CP001349.PE537

CP001349.PE537       Location/Qualifiers
FT   CDS             616337..616603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55589"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55589.1"
FT                   /translation="MSCRSPRRAYDENGREILPPTIDMLRAEANRTAAVNLLLPARDKE
FT                   IGLARLVLRASSAPAARSRMPGLYSARSNQQFHVSAEASSPAG"
     MSCRSPRRAY DENGREILPP TIDMLRAEAN RTAAVNLLLP ARDKEIGLAR LVLRASSAPA        60
     ARSRMPGLYS ARSNQQFHVS AEASSPAG                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page