(data stored in ACNUC7421 zone)

EMBL: CP001349.PE539

CP001349.PE539       Location/Qualifiers
FT   CDS             617017..617244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_7034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55591"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55591.1"
FT                   /translation="MILNALALKLKRQTRGDFKGRHFEATLIIQAVSWYLRYALIRGAV
FT                   LFASTTWDELPSSSCKRTPCPPSQPRYARP"
     MILNALALKL KRQTRGDFKG RHFEATLIIQ AVSWYLRYAL IRGAVLFAST TWDELPSSSC        60
     KRTPCPPSQP RYARP                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page