(data stored in ACNUC7421 zone)

EMBL: CP001349.PE54

CP001349.PE54        Location/Qualifiers
FT   CDS             complement(61654..62532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0055"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0055
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55106"
FT                   /db_xref="GOA:B8IU61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU61"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55106.1"
FT                   /translation="MTTASTLGLDRRPEILRETSAAGAITVEQRLSLPELLYRQGWLRK
FT                   CAVLATLAVLWEVYGRWLDNPLLFPTFSATVEAFGTAILSGEIPAKALISLQTLAIGYG
FT                   IGIALAAILTTIAIGSRIGTDLLETLTAMFNPLPAIALLPLALIWFGLGQGSVVFVLVH
FT                   SVLWAIALNTHAGFRSVSNTLRMVGLNYGLRNLRLVRAILIPAAFPSILTGLKVGWAFA
FT                   WRTLIAAELVFGVSSGSGGLGWYIFENRNALETTNVFAGLFTVILIGLFVENVVFANIE
FT                   KRTIRRWGMQH"
     MTTASTLGLD RRPEILRETS AAGAITVEQR LSLPELLYRQ GWLRKCAVLA TLAVLWEVYG        60
     RWLDNPLLFP TFSATVEAFG TAILSGEIPA KALISLQTLA IGYGIGIALA AILTTIAIGS       120
     RIGTDLLETL TAMFNPLPAI ALLPLALIWF GLGQGSVVFV LVHSVLWAIA LNTHAGFRSV       180
     SNTLRMVGLN YGLRNLRLVR AILIPAAFPS ILTGLKVGWA FAWRTLIAAE LVFGVSSGSG       240
     GLGWYIFENR NALETTNVFA GLFTVILIGL FVENVVFANI EKRTIRRWGM QH               292
//

If you have problems or comments...

PBIL Back to PBIL home page