(data stored in ACNUC7421 zone)

EMBL: CP001349.PE540

CP001349.PE540       Location/Qualifiers
FT   CDS             617701..617904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55592"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55592.1"
FT                   /translation="MDVATRVKGAVVTTTLALDTAASATVTMGLGPVSGIAGMTGNPQA
FT                   HRTGAMGSAVSTVLIPMKSRTS"
     MDVATRVKGA VVTTTLALDT AASATVTMGL GPVSGIAGMT GNPQAHRTGA MGSAVSTVLI        60
     PMKSRTS                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page