(data stored in ACNUC7421 zone)

EMBL: CP001349.PE541

CP001349.PE541       Location/Qualifiers
FT   CDS             complement(617963..618247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0555"
FT                   /product="DNA-directed DNA polymerase"
FT                   /note="KEGG: mrd:Mrad2831_6255 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55593"
FT                   /db_xref="GOA:B8IDM1"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM1"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6255"
FT                   /protein_id="ACL55593.1"
FT                   /translation="MPLYSKAGVITTDILPPAESPRALFGALDRERGGPLMAAMDACNR
FT                   RFGRGTVVPARAGLERKRTWATKFEMRSPRYTTKLAELPVATAHLWEPL"
     MPLYSKAGVI TTDILPPAES PRALFGALDR ERGGPLMAAM DACNRRFGRG TVVPARAGLE        60
     RKRTWATKFE MRSPRYTTKL AELPVATAHL WEPL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page