(data stored in ACNUC7421 zone)

EMBL: CP001349.PE542

CP001349.PE542       Location/Qualifiers
FT   CDS             complement(618410..620704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0556"
FT                   /product="proprotein convertase P"
FT                   /note="KEGG: bid:Bind_3695 proprotein convertase P"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55594"
FT                   /db_xref="GOA:B8IDM2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM2"
FT                   /inference="similar to AA sequence:KEGG:Bind_3695"
FT                   /protein_id="ACL55594.1"
FT                   /translation="MPSGGQNDDVFDGNPGVSDNFDGSGGSDTISYITSPRGVSINLAA
FT                   GATFDGVTFDFLSSIENAVGSDFNDTLQGDAGSNRLDGSGGNDTVSYASSTRGVSINLA
FT                   AGATFDGVTFDFLSSIENAAGSDFNDTLQGDAGSNRLDGGAGDDTVSYAASNRAVTIDL
FT                   AAQATYDGVVGDVLASIENAIGSQFDDSIQGGYGSNRLDGGAGNDTVFYAASTRAMTIN
FT                   LATQIADDGMFVDTLVSIENVQGTNFNDVIVGDAGNNTIDGGAGGSDTLQGGGGSDTVS
FT                   YGHASQGVSINLAAGATFDGVTFDLLSSIENAVGSDFNDTLQGDAGSNRLDGSGGNDTV
FT                   SYASSTRGVSINLAAGAAFDGVTFDFLSSIENAVGSDFNDTLQGGVGSNRLDGGAGDDT
FT                   VNYAASNHAITLDLASEYAYDGNSYDTLISVENVEGTGFNDLIYGDFKNNVIDGGAGGS
FT                   DTIYGGDGTDTISYSSASQGVSVNLAAGATYDGVTFDFLNSIENVVGSKFNDSLQGNSG
FT                   SNLFDGGAGTDTLSYTSSARELNVYLGSNSISDGNATDYYSNIESIVGSGLYDRFVVSG
FT                   SDFGSVKNIDGSGGLDTLDLAGSNITTILYNGINVNLASHYVYADVSQPRVPQLGFSIY
FT                   NVENVNGSNLYDYIVGDDADNIINGGGGTPIFSRPIGRSGDILTGNGGNDTFVFVMGQA
FT                   NGDTITDFQGNGPSAGDRLEFRGFGTAEQGATLTQINATQYSINSADGKVHEVINLTNS
FT                   AVINSSDYTFV"
     MPSGGQNDDV FDGNPGVSDN FDGSGGSDTI SYITSPRGVS INLAAGATFD GVTFDFLSSI        60
     ENAVGSDFND TLQGDAGSNR LDGSGGNDTV SYASSTRGVS INLAAGATFD GVTFDFLSSI       120
     ENAAGSDFND TLQGDAGSNR LDGGAGDDTV SYAASNRAVT IDLAAQATYD GVVGDVLASI       180
     ENAIGSQFDD SIQGGYGSNR LDGGAGNDTV FYAASTRAMT INLATQIADD GMFVDTLVSI       240
     ENVQGTNFND VIVGDAGNNT IDGGAGGSDT LQGGGGSDTV SYGHASQGVS INLAAGATFD       300
     GVTFDLLSSI ENAVGSDFND TLQGDAGSNR LDGSGGNDTV SYASSTRGVS INLAAGAAFD       360
     GVTFDFLSSI ENAVGSDFND TLQGGVGSNR LDGGAGDDTV NYAASNHAIT LDLASEYAYD       420
     GNSYDTLISV ENVEGTGFND LIYGDFKNNV IDGGAGGSDT IYGGDGTDTI SYSSASQGVS       480
     VNLAAGATYD GVTFDFLNSI ENVVGSKFND SLQGNSGSNL FDGGAGTDTL SYTSSARELN       540
     VYLGSNSISD GNATDYYSNI ESIVGSGLYD RFVVSGSDFG SVKNIDGSGG LDTLDLAGSN       600
     ITTILYNGIN VNLASHYVYA DVSQPRVPQL GFSIYNVENV NGSNLYDYIV GDDADNIING       660
     GGGTPIFSRP IGRSGDILTG NGGNDTFVFV MGQANGDTIT DFQGNGPSAG DRLEFRGFGT       720
     AEQGATLTQI NATQYSINSA DGKVHEVINL TNSAVINSSD YTFV                        764
//

If you have problems or comments...

PBIL Back to PBIL home page