(data stored in ACNUC7421 zone)

EMBL: CP001349.PE543

CP001349.PE543       Location/Qualifiers
FT   CDS             complement(620838..622118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0557"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: met:M446_5531
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55595"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM3"
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /protein_id="ACL55595.1"
FT                   /translation="MSRRELERLSKEELIELVLRLQRPEKTSRTSSKPPSTDRKERREQ
FT                   ARPGGAKPGHEGHSRVISGDPDAVVEHRPDRCSCCGGALHGDLPAEVVSVAEQVELPEV
FT                   TPIVTQHQRLAVLCPSCGAHVVAPVPSAARGTPFGPRLHAVATYLKTFQALSYERLQAA
FT                   LSDLFGLTLSQGGLMNMLRRAQGYFRPGREAAVSALRRAAVVASDETGVRIEGCTAYHW
FT                   VFRSAEAVVHHASPTRGAVVVHEMMDGHRPVVWISDRYTAQQGHAAKHQTCLAHLARDV
FT                   AYAVEVSDDPGPLRLQLWLQAVFALAERVTDLAASTLSAKRRALERRLSEILSAPSRCD
FT                   LTRDLQAKIGRARDQLLVFLDHPGTVEITNNGCERLLRPAVVQRKVTNGYRARWAANGE
FT                   ADLRTVVDTARLTGARPFATILQTIGA"
     MSRRELERLS KEELIELVLR LQRPEKTSRT SSKPPSTDRK ERREQARPGG AKPGHEGHSR        60
     VISGDPDAVV EHRPDRCSCC GGALHGDLPA EVVSVAEQVE LPEVTPIVTQ HQRLAVLCPS       120
     CGAHVVAPVP SAARGTPFGP RLHAVATYLK TFQALSYERL QAALSDLFGL TLSQGGLMNM       180
     LRRAQGYFRP GREAAVSALR RAAVVASDET GVRIEGCTAY HWVFRSAEAV VHHASPTRGA       240
     VVVHEMMDGH RPVVWISDRY TAQQGHAAKH QTCLAHLARD VAYAVEVSDD PGPLRLQLWL       300
     QAVFALAERV TDLAASTLSA KRRALERRLS EILSAPSRCD LTRDLQAKIG RARDQLLVFL       360
     DHPGTVEITN NGCERLLRPA VVQRKVTNGY RARWAANGEA DLRTVVDTAR LTGARPFATI       420
     LQTIGA                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page