(data stored in ACNUC7421 zone)

EMBL: CP001349.PE544

CP001349.PE544       Location/Qualifiers
FT   CDS             complement(622354..622869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0559"
FT                   /product="peptidase S24 and S26 domain protein"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   mpo:Mpop_0340 peptidase S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55596"
FT                   /db_xref="GOA:B8IDM4"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM4"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACL55596.1"
FT                   /translation="MSLYRVGEQAADWSGLVRIPFMRTTLCAGFPSSAEDFTEGALELP
FT                   RWLAPNPAATFIWRVRGWCMKGAGIHDQDLAVVDRSLHPSPGAVVVAIVNGEMSLKRLV
FT                   LDGNRLALTFDNPEMPAFGLEDLEECQIWGVLLFSVRWHHVRPSPLRWPRHRAGRRQQL
FT                   LLLLREGV"
     MSLYRVGEQA ADWSGLVRIP FMRTTLCAGF PSSAEDFTEG ALELPRWLAP NPAATFIWRV        60
     RGWCMKGAGI HDQDLAVVDR SLHPSPGAVV VAIVNGEMSL KRLVLDGNRL ALTFDNPEMP       120
     AFGLEDLEEC QIWGVLLFSV RWHHVRPSPL RWPRHRAGRR QQLLLLLREG V                171
//

If you have problems or comments...

PBIL Back to PBIL home page