(data stored in ACNUC7421 zone)

EMBL: CP001349.PE545

CP001349.PE545       Location/Qualifiers
FT   CDS             complement(624239..626215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3393 putative ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55597"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55597.1"
FT                   /translation="MLTKQDKQQKITYCTNMNEVFEAKLGSADLLLNWDHLRGRIRDRV
FT                   DAGDIGSAFLKLALDVAHVLPDGVDDQLARAAFHFQSAKGAKSKHADSVQAGLRVLSID
FT                   LGVRSFATCSVFELKDTAPTTGVAFPLAEFRLWAVHERSFTLELPGENVGAAGQQWRAQ
FT                   ADAELRQLRGGLNRHRQLLRAATVQKGERDAYLTDLREAWSAKELWPFEASLLSELERC
FT                   STVADPLWQDTCKRAARLYRTEFGAVVSEWRSRTRSREDRKYAGKSMWSVQHLTDVRRF
FT                   LQSWSLAGRASGDIRRLDRERGGVFAKDLLDHIDALKDDRLKTGADLIVQAARGFQRNE
FT                   FGYWVQKHAPCHVILFEDLSRYRMRTDRPRRENSQLMQWAHRGVPDMVGMQGEIYGIQD
FT                   RRDPDSARKHARQPLAAFCLDTPAAFSSRYHASTMTPGIRCHPLRKREFEDQGFLELLK
FT                   RENEGLDLNGYKPGDLVPLPGGEVFVCLNANGLSRIHADINAAQNLQRRFWTQHGDAFR
FT                   LPCGKSAVQGQIRWAPLSMGKRQAGALGGFGYLEPTGHDSGSCQWRKTTEAEWRRLSGA
FT                   QKDRDEAAAAEDEELQGLEEELLERSGERVVFFRDPSGVVLPTDLWFPSAAFWSIVRAK
FT                   TVGRLRSHLDAQAEASYAVAAGL"
     MLTKQDKQQK ITYCTNMNEV FEAKLGSADL LLNWDHLRGR IRDRVDAGDI GSAFLKLALD        60
     VAHVLPDGVD DQLARAAFHF QSAKGAKSKH ADSVQAGLRV LSIDLGVRSF ATCSVFELKD       120
     TAPTTGVAFP LAEFRLWAVH ERSFTLELPG ENVGAAGQQW RAQADAELRQ LRGGLNRHRQ       180
     LLRAATVQKG ERDAYLTDLR EAWSAKELWP FEASLLSELE RCSTVADPLW QDTCKRAARL       240
     YRTEFGAVVS EWRSRTRSRE DRKYAGKSMW SVQHLTDVRR FLQSWSLAGR ASGDIRRLDR       300
     ERGGVFAKDL LDHIDALKDD RLKTGADLIV QAARGFQRNE FGYWVQKHAP CHVILFEDLS       360
     RYRMRTDRPR RENSQLMQWA HRGVPDMVGM QGEIYGIQDR RDPDSARKHA RQPLAAFCLD       420
     TPAAFSSRYH ASTMTPGIRC HPLRKREFED QGFLELLKRE NEGLDLNGYK PGDLVPLPGG       480
     EVFVCLNANG LSRIHADINA AQNLQRRFWT QHGDAFRLPC GKSAVQGQIR WAPLSMGKRQ       540
     AGALGGFGYL EPTGHDSGSC QWRKTTEAEW RRLSGAQKDR DEAAAAEDEE LQGLEEELLE       600
     RSGERVVFFR DPSGVVLPTD LWFPSAAFWS IVRAKTVGRL RSHLDAQAEA SYAVAAGL         658
//

If you have problems or comments...

PBIL Back to PBIL home page