(data stored in ACNUC7421 zone)

EMBL: CP001349.PE546

CP001349.PE546       Location/Qualifiers
FT   CDS             complement(626253..627647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55598"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55598.1"
FT                   /translation="MPVRSLKLKIVVPRHPSELEKAQALWSTHRLVNEAVSFYEQKLLL
FT                   LRGETYSTSDGSVPQDEVRRQLLEQAREAQARNGGSGGSDDEIVRLCRSLYEAIVLADD
FT                   ANAQLANAFLGPLTDPNSAGFLEAFNKVDRPAPSWLDQVPASDPIDPAVLAEANAWLDT
FT                   DAGRAWLVDTGAPPRWRSLAAKQDPIWPREFARKLGELRKEAASGTSAIIKALKRDFGV
FT                   LPLFQPSLAPRILGSRSSLTPWDRLAFRLAVGHLLSWESWCTRARDEHTARVQRLEQFS
FT                   SAHLKGDLATKVSTLREYERARKEQIAQLGLPMGERDFLITVRMTRGWDDLREKWRRSG
FT                   DKGQEALHAIIATEQTRKRGRFGDPDLFRWLARPENHHVWADGHADAVGVLARVNAMER
FT                   LVERSRDTALMTLPDPVAHPRSAQWEAEGGSNLRNYQLEAVGGELQITLPLLKAADDGR
FT                   CIDTPL"
     MPVRSLKLKI VVPRHPSELE KAQALWSTHR LVNEAVSFYE QKLLLLRGET YSTSDGSVPQ        60
     DEVRRQLLEQ AREAQARNGG SGGSDDEIVR LCRSLYEAIV LADDANAQLA NAFLGPLTDP       120
     NSAGFLEAFN KVDRPAPSWL DQVPASDPID PAVLAEANAW LDTDAGRAWL VDTGAPPRWR       180
     SLAAKQDPIW PREFARKLGE LRKEAASGTS AIIKALKRDF GVLPLFQPSL APRILGSRSS       240
     LTPWDRLAFR LAVGHLLSWE SWCTRARDEH TARVQRLEQF SSAHLKGDLA TKVSTLREYE       300
     RARKEQIAQL GLPMGERDFL ITVRMTRGWD DLREKWRRSG DKGQEALHAI IATEQTRKRG       360
     RFGDPDLFRW LARPENHHVW ADGHADAVGV LARVNAMERL VERSRDTALM TLPDPVAHPR       420
     SAQWEAEGGS NLRNYQLEAV GGELQITLPL LKAADDGRCI DTPL                        464
//

If you have problems or comments...

PBIL Back to PBIL home page