(data stored in ACNUC7421 zone)

EMBL: CP001349.PE547

CP001349.PE547       Location/Qualifiers
FT   CDS             complement(627980..628339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55599"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55599.1"
FT                   /translation="MSIDRRLLARARAPLSVQYRYCCRRLIEDAIEALITCLDEADGDP
FT                   DLEDEGDDEPSLGSPERTAEFGVTVIDGDRYHILSTSQIRWGDGGTMDCEVEDEHDEDG
FT                   GDAEPDGDEHDDGSS"
     MSIDRRLLAR ARAPLSVQYR YCCRRLIEDA IEALITCLDE ADGDPDLEDE GDDEPSLGSP        60
     ERTAEFGVTV IDGDRYHILS TSQIRWGDGG TMDCEVEDEH DEDGGDAEPD GDEHDDGSS        119
//

If you have problems or comments...

PBIL Back to PBIL home page