(data stored in ACNUC7421 zone)

EMBL: CP001349.PE549

CP001349.PE549       Location/Qualifiers
FT   CDS             complement(629215..629622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55601"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55601.1"
FT                   /translation="MTPLELAGLLKDYGPWSLLALTLLAMSYLQRRYDAVTEKYQSNLE
FT                   ALIGKLAVTVERNNGTNAAVTAALESRTGIFERLHEAVEQAKAETRTLITDLKNHGVIN
FT                   DQWTREKLDMTVGRIETILEHIDELRRGMGR"
     MTPLELAGLL KDYGPWSLLA LTLLAMSYLQ RRYDAVTEKY QSNLEALIGK LAVTVERNNG        60
     TNAAVTAALE SRTGIFERLH EAVEQAKAET RTLITDLKNH GVINDQWTRE KLDMTVGRIE       120
     TILEHIDELR RGMGR                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page