(data stored in ACNUC7421 zone)

EMBL: CP001349.PE55

CP001349.PE55        Location/Qualifiers
FT   CDS             complement(62722..63492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0056"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_0056 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55107"
FT                   /db_xref="GOA:B8IU62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU62"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55107.1"
FT                   /translation="MNARPSLVPEPLLSVQGVTLQYKTSDHLVTATYRVDFEVLPGDRY
FT                   ILLGPSGCGKSTLLKAIGGYLTPVEGEIRLKGRKVSEPGPDRMMVFQEFDQLLPWKTVK
FT                   QNVAFALTASGRASGPEAMDRAMAYIEKVGLAKFADSYPHMLSGGMKQRVAIARGMAME
FT                   PDILLMDEPFAALDALTRRKMQDELLRLWEDTRFTVLFVTHSIEEAIKVGTRILLLSPH
FT                   PGQVRAELNSLAPSELGTAAQGALEARINDMLFA"
     MNARPSLVPE PLLSVQGVTL QYKTSDHLVT ATYRVDFEVL PGDRYILLGP SGCGKSTLLK        60
     AIGGYLTPVE GEIRLKGRKV SEPGPDRMMV FQEFDQLLPW KTVKQNVAFA LTASGRASGP       120
     EAMDRAMAYI EKVGLAKFAD SYPHMLSGGM KQRVAIARGM AMEPDILLMD EPFAALDALT       180
     RRKMQDELLR LWEDTRFTVL FVTHSIEEAI KVGTRILLLS PHPGQVRAEL NSLAPSELGT       240
     AAQGALEARI NDMLFA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page