(data stored in ACNUC7421 zone)

EMBL: CP001349.PE550

CP001349.PE550       Location/Qualifiers
FT   CDS             complement(629794..629988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_5980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55602"
FT                   /db_xref="GOA:B8IDN0"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN0"
FT                   /inference="similar to AA sequence:KEGG:M446_5980"
FT                   /protein_id="ACL55602.1"
FT                   /translation="MTKFLTPGVVAGALTFGAAVAMAAGKPALAAILNDPATASTATNI
FT                   LIGAGALLAGYLRGGKRAA"
     MTKFLTPGVV AGALTFGAAV AMAAGKPALA AILNDPATAS TATNILIGAG ALLAGYLRGG        60
     KRAA                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page