(data stored in ACNUC7421 zone)

EMBL: CP001349.PE551

CP001349.PE551       Location/Qualifiers
FT   CDS             complement(630039..630797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4117 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55603"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55603.1"
FT                   /translation="MDRSISPGAAIVLDFIGQTEAPNGYGTIYANGQAKLGIDITTWTL
FT                   DQVEAEQPAWTRRFGSSACGRYQFMRDTLDKPGTIQDIEGEMGLTGRELFSPDLQDRMA
FT                   MHLLRRRGWDSFIAGRLTMAGFALSLAKEWASLPVLATTKGRKRTVMRGQSYYAGDGRN
FT                   RALVSADTVEAMLARALAAERSNPGQNSPGGKSLPDKAPPPLVADADVSPSKVAQPAPS
FT                   GGLSSGPTLSTAPAPTVAPWWRRALAWLSA"
     MDRSISPGAA IVLDFIGQTE APNGYGTIYA NGQAKLGIDI TTWTLDQVEA EQPAWTRRFG        60
     SSACGRYQFM RDTLDKPGTI QDIEGEMGLT GRELFSPDLQ DRMAMHLLRR RGWDSFIAGR       120
     LTMAGFALSL AKEWASLPVL ATTKGRKRTV MRGQSYYAGD GRNRALVSAD TVEAMLARAL       180
     AAERSNPGQN SPGGKSLPDK APPPLVADAD VSPSKVAQPA PSGGLSSGPT LSTAPAPTVA       240
     PWWRRALAWL SA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page