(data stored in ACNUC7421 zone)

EMBL: CP001349.PE553

CP001349.PE553       Location/Qualifiers
FT   CDS             complement(631281..633635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55605"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55605.1"
FT                   /translation="MRNLSRAVWLAAAVAVLAAPAVSLDLRRYINSGGEPPLTGAYALG
FT                   PGELVINSTDKKLFFRATDNTLGVATLLNASVAGKKAVEQGDAGDLVVTPSGSGSAQAV
FT                   KDLFSAVPVISGGAVSLLNGPTLGTWQAGKFTVTPDRLQASAATRASNPYAGPYPSWVQ
FT                   GIGLGNGPYSGFYDIKPLATATLYAPDGSVALTNRHTYGSLNTSGTLTVSANVDRPGCV
FT                   AGFTHPGQASAYDELGAYALCTQIDSVPLMAAVAGTFTATTFVPTTPITLSDTVYLGVG
FT                   MWIRTNDTPARYNGQIESWTTNGNGQVTSITVSQWTQRGGSAGTPAGTMAFINPQDKLW
FT                   NRLETTFLNAIKVTGTTVSDSKTVSVSSTDGLYPGGQLVAGPGIQPNTVITDVNYTGNT
FT                   ITLEKAATASGTVTLVISAGTEFGKGVGVEGDIFNAGPPFIPTEISGGTGNVTASSRTI
FT                   TGVTNISVWRSGIMVYGVGIPAGNLVTAVDTANSTLTLKYPATASGTGVALKAKHQLDE
FT                   GGTFADCVGVTNNINTCYLNRGSVSYGFVSMGAGEASFLVQPDLFAGIPKYGYQVNGTY
FT                   NGMPSIAAFAVTSDGTTLWKVDGAGNETVQSVTAQSVTAAGAVSGASLAATGAVSGASA
FT                   SIAGAVSAGSVSATGALSGASADVTGTYKVGGTTVLDNAAWTAYVPTVSCVTTGSLTVG
FT                   TVTARYKRIGKTVSVTVKAQLTANTCADGINVTVPVPVAADAPLYGRDIGTGVLLAGLA
FT                   AAGGGVAFVHRYDGGAPSAGGVLFSLTYETP"
     MRNLSRAVWL AAAVAVLAAP AVSLDLRRYI NSGGEPPLTG AYALGPGELV INSTDKKLFF        60
     RATDNTLGVA TLLNASVAGK KAVEQGDAGD LVVTPSGSGS AQAVKDLFSA VPVISGGAVS       120
     LLNGPTLGTW QAGKFTVTPD RLQASAATRA SNPYAGPYPS WVQGIGLGNG PYSGFYDIKP       180
     LATATLYAPD GSVALTNRHT YGSLNTSGTL TVSANVDRPG CVAGFTHPGQ ASAYDELGAY       240
     ALCTQIDSVP LMAAVAGTFT ATTFVPTTPI TLSDTVYLGV GMWIRTNDTP ARYNGQIESW       300
     TTNGNGQVTS ITVSQWTQRG GSAGTPAGTM AFINPQDKLW NRLETTFLNA IKVTGTTVSD       360
     SKTVSVSSTD GLYPGGQLVA GPGIQPNTVI TDVNYTGNTI TLEKAATASG TVTLVISAGT       420
     EFGKGVGVEG DIFNAGPPFI PTEISGGTGN VTASSRTITG VTNISVWRSG IMVYGVGIPA       480
     GNLVTAVDTA NSTLTLKYPA TASGTGVALK AKHQLDEGGT FADCVGVTNN INTCYLNRGS       540
     VSYGFVSMGA GEASFLVQPD LFAGIPKYGY QVNGTYNGMP SIAAFAVTSD GTTLWKVDGA       600
     GNETVQSVTA QSVTAAGAVS GASLAATGAV SGASASIAGA VSAGSVSATG ALSGASADVT       660
     GTYKVGGTTV LDNAAWTAYV PTVSCVTTGS LTVGTVTARY KRIGKTVSVT VKAQLTANTC       720
     ADGINVTVPV PVAADAPLYG RDIGTGVLLA GLAAAGGGVA FVHRYDGGAP SAGGVLFSLT       780
     YETP                                                                    784
//

If you have problems or comments...

PBIL Back to PBIL home page