(data stored in ACNUC7421 zone)

EMBL: CP001349.PE554

CP001349.PE554       Location/Qualifiers
FT   CDS             complement(633645..634376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55606"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55606.1"
FT                   /translation="MATMLYTVLAASGGWVAGQEVAIGSQIALTDVEARYELDLGTIAP
FT                   TGQEPPQPPPPPALLDGDLIETRRGSLDRAIVIAALEVFLTRVGGGIAQYVDARDAALV
FT                   ASLSAQGATLAGLRAALVGTADAQHDTLGKLQTALAGLSATLADKAAASELAALDARTN
FT                   HLDNTSDATKAQPGNPIGDAIAAAALKGRLLAKTTAPALGDLADGQWSLICDTSTTPPT
FT                   FVLAARVGGALSTFVLNPPAA"
     MATMLYTVLA ASGGWVAGQE VAIGSQIALT DVEARYELDL GTIAPTGQEP PQPPPPPALL        60
     DGDLIETRRG SLDRAIVIAA LEVFLTRVGG GIAQYVDARD AALVASLSAQ GATLAGLRAA       120
     LVGTADAQHD TLGKLQTALA GLSATLADKA AASELAALDA RTNHLDNTSD ATKAQPGNPI       180
     GDAIAAAALK GRLLAKTTAP ALGDLADGQW SLICDTSTTP PTFVLAARVG GALSTFVLNP       240
     PAA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page